PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g18977.1.p
Common NameBRADI_3g18977, LOC100827497
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 318aa    MW: 35134.8 Da    PI: 6.0947
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g18977.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-161462148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      rg+W++eEd  l+ +++++G+g +W + ++++g++R++k+c++rw++yl
  Bradi3g18977.1.p 14 RGPWSPEEDAMLKAYIEEHGTGnNWIALPHKIGLKRCGKSCRLRWLNYL 62
                      89*********************************************97 PP

2Myb_DNA-binding38.62.4e-1269111246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       g +T+eEd  +  +    G++ W+ Ia+ ++ gRt++++k++w++
  Bradi3g18977.1.p  69 GDFTPEEDSTICSLYISIGSR-WSIIAAQLP-GRTDNDVKNYWNT 111
                       789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.132962IPR017930Myb domain
SuperFamilySSF466898.36E-2712109IPR009057Homeodomain-like
SMARTSM007172.7E-131364IPR001005SANT/Myb domain
PfamPF002494.2E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-241569IPR009057Homeodomain-like
CDDcd001674.64E-101662No hitNo description
PROSITE profilePS5129420.92363117IPR017930Myb domain
SMARTSM007175.3E-1167115IPR001005SANT/Myb domain
PfamPF002496.5E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.7E-2370117IPR009057Homeodomain-like
CDDcd001671.90E-771113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRAPCCDKA TVKRGPWSPE EDAMLKAYIE EHGTGNNWIA LPHKIGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTPEEDSTIC SLYISIGSRW SIIAAQLPGR TDNDVKNYWN TKLKKRLLGG  120
RRKGRGTHHR PQSDATNAET DGGANNDGEE RSLSASAMER IQLCMQLQEM QNPLGISSHQ  180
YNPLQQQMWP NNHHQVPTQS NSSGSSSLNV TVAAEQGQSS SMNDQCNGFR QLETAAVDDG  240
LASPSSPKNS NVVTIEAELQ ELLYGTTSTT TTDSVAVSQQ GGADWWSYDQ DRSAVNCWDF  300
TPETSSVFQD YTSVYDI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3zqc_A6e-23141172103MYB3
3zqc_D6e-23141172103MYB3
3zqc_G6e-23141172103MYB3
3zqc_J6e-23141172103MYB3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117881e-124AK111788.1 Oryza sativa Japonica Group cDNA clone:J023093J22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573606.10.0PREDICTED: transcription factor RAX3
SwissprotQ9FKL21e-82MYB36_ARATH; Transcription factor MYB36
TrEMBLI1I2B10.0I1I2B1_BRADI; Uncharacterized protein
STRINGBRADI3G18977.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-76myb domain protein 36